PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK04961.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 60aa    MW: 7210.12 Da    PI: 4.5639
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK04961.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM39.61.7e-12240948
        NAM  9 PtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
               Pt+eel+++yLkkkv++++++l +vi++vd++k+ePwd++
  PK04961.2  2 PTEEELLQYYLKKKVSNQSIDL-DVIRDVDLNKLEPWDIQ 40
               **********************.9**************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100513.727160IPR003441NAC domain
PfamPF023651.6E-4245IPR003441NAC domain
SuperFamilySSF1019417.06E-12243IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
XPTEEELLQY YLKKKVSNQS IDLDVIRDVD LNKLEPWDIQ GIFIYLIIFL HTRCGTIYIY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007220855.12e-20hypothetical protein PRUPE_ppa020746mg
RefseqXP_008233055.12e-20PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP67e-19NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM5X7Y12e-20M5X7Y1_PRUPE; Uncharacterized protein
STRINGBGIOSGA027881-PA1e-17(Oryza sativa Indica Group)
STRINGGLYMA19G44910.13e-17(Glycine max)
STRINGGLYMA07G05660.13e-17(Glycine max)
STRINGGLYMA16G02200.24e-17(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.14e-20NAC family protein